PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10004949m
Common NameEUTSA_v10004949mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 200aa    MW: 22711.3 Da    PI: 9.6292
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10004949mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.38.3e-23956148
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                     krienks rqv+f+kRrng++ KA  LS+LCd  va++i+sstgkly 
  Thhalv10004949m  9 KRIENKSSRQVSFCKRRNGLMEKARQLSILCDSSVALLIVSSTGKLYS 56
                     79********************************************96 PP

2K-box34.77.3e-131111644598
            K-box  45 sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      ++s++ L +Le+q +++l+  R++Knel++e +++lq+kek+l+ en+ L ++l
  Thhalv10004949m 111 NISIESLISLEEQFKTALSVTRARKNELMMELVKTLQEKEKMLRAENQVLVSQL 164
                      5699**********************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.385161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-26173IPR002100Transcription factor, MADS-box
CDDcd002659.33E-32271No hitNo description
PRINTSPR004048.8E-24323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-211056IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.54770170IPR002487Transcription factor, K-box
PfamPF014863.6E-9108164IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010048Biological Processvernalization response
GO:0048587Biological Processregulation of short-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MGRRKVEIKR IENKSSRQVS FCKRRNGLME KARQLSILCD SSVALLIVSS TGKLYSSSSG  60
DSMAKILKRY EIQHADELKT LGLAEKTRNY LSHKELLEIV QCKLEETNGD NISIESLISL  120
EEQFKTALSV TRARKNELMM ELVKTLQEKE KMLRAENQVL VSQLTKMEGK RFLETEYERA  180
MSPENSSGNN PPETLPLLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-16270168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394081.11e-142hypothetical protein EUTSA_v10004949mg
SwissprotQ683D72e-97MAF5_ARATH; Protein MADS AFFECTING FLOWERING 5
TrEMBLV4KN531e-142V4KN53_EUTSA; Uncharacterized protein
STRINGBra031884.1-P1e-114(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM9861987
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65070.14e-94MIKC_MADS family protein